Invitrogen™ Human RC3H2 (aa 906-1003) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92881	100 μL

Catalog No. RP92881 Supplier Invitrogen™ Supplier No. RP92881

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60151. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RC3H2 gene ontology annotations related to this gene include B cell homeostasis; limb development; lung alveolus development; lymph node development; multicellular organism growth; negative regulation of T-helper 17 cell differentiation; positive regulation of NIK/NF-kappaB signaling; post-embryonic development; posttranscriptional regulation of gene expression; regulation of miRNA metabolic process; spleen development; T cell homeostasis; T cell proliferation; T cell receptor signaling pathway; T follicular helper cell differentiation.

Specifications

• Accession Number: Q9HBD1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 54542
• Name: Human RC3H2 (aa 906-1003) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: FLJ20301; FLJ20713; membrane associated DNA binding protein; membrane-associated nucleic acid binding protein; membrane-associated nucleic acid-binding protein; MNAB; RC3H2; ring finger and CCCH-type domains 2; ring finger and CCCH-type zinc finger domain-containing protein 2; ring finger and CCCH-type zinc finger domains 2; RING finger protein 164; RING-type E3 ubiquitin transferase Roquin-2; RNF164; Roquin-2
• Common Name: RC3H2
• Gene Symbol: RC3H2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GAISRSSRTGYHTTDPVQATASQGSATKPISVSDYVPYVNAVDSRWSSYGNEATSSAHYVERDRFIVTDLSGHRKHSSTGDLLSLELQQAKSNSLLLQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining