Invitrogen™ Human RFX7 (aa 300-393) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95747	100 μL

Catalog No. RP95747 Supplier Invitrogen™ Supplier No. RP95747

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57278. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RFX7 is a member of the regulatory factor X (RFX) family of transcription factors.

Specifications

• Accession Number: Q2KHR2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 64864
• Name: Human RFX7 (aa 300-393) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: DNA-binding protein RFX7; Regulatory factor X 7; regulatory factor X domain containing 2; regulatory factor X domain-containing protein 2; regulatory factor X, 7; regulatory factor X7; RFX7; RFXDC2
• Common Name: RFX7
• Gene Symbol: RFX7
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VVTQHMQSVKQAPKTPQNVPASPGGDRSARHRYPQILPKPANTSALTIRSPTTVLFTSSPIKTAVVPASHMSSLNVVKMTTISLTPSNSNTPLK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining