Invitrogen™ Human RFX8 (aa 273-354) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105138	100 μL

Catalog No. RP105138 Supplier Invitrogen™ Supplier No. RP105138

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66278. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RFX8 may be a transcription factor.

Specifications

• Accession Number: Q6ZV50
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 731220
• Name: Human RFX8 (aa 273-354) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: DNA-binding protein RFX8; Regulatory factor X 8; regulatory factor X, 8; RFX family member 8, lacking RFX DNA binding domain; RFX gene family member 8, lacking RFX DNA binding domain; RFX8
• Common Name: RFX8
• Gene Symbol: RFX8
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLQISKLKEVTLFVKRLRRKTYLSNMAKTMRMVLKSKRRVSVLKSDLQAIINQGTLATSKKALASDRSGADELENNPEMKCL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining