Invitrogen™ Human RGS2 (aa 121-198) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104559	100 μL

Catalog No. RP104559 Supplier Invitrogen™ Supplier No. RP104559

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 2 belongs to this family. The protein acts as a mediator of myeloid differentiation and may play a role in leukemogenesis.

Specifications

• Accession Number: P41220
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5997
• Name: Human RGS2 (aa 121-198) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: cell growth-inhibiting gene 31 protein; cell growth-inhibiting protein 31; G0 to G1 switch regulatory 8, 24kD; G0/G1 switch regulatory protein 8; G0S8; GIG31; GOS8; regulator of G protein signaling 2; regulator of G protein signaling 2; regulator of G-protein signaling 2; regulator of G-protein signaling 2; regulator of G-protein signaling 2, 24kDa; regulator of G-protein signaling protein 2; regulator of G-protein signalling 2, 24kDa; Rgs2
• Common Name: RGS2
• Gene Symbol: RGS2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining