Invitrogen™ Human RhoH (aa 22-96) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108994	100 μL

Catalog No. RP108994 Supplier Invitrogen™ Supplier No. RP108994

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Rho subfamily of small GTP-binding proteins mediates many fundamental cellular functions. The commonly studied members (Rho, Rac, and CDC42) regulate actin reorganization and affect diverse cellular responses, including adhesion, cytokinesis, and motility. RhoH, also known as TTF (Translocation Three Four), Rho-related GTP-binding protein and ras homolog gene family member H, is unlike most other small G proteins. Most small G proteins are expressed ubiquitously, however, Rho H is expressed only in hemopoietic cells and tissues. Translocations and a high frequency of Rho H mutation have been detected in primary lymphoma cells. Rho H expression has also been observed in activated neutrophils. RhoH is GTPase deficient, remaining in a GTP-bound activated state without cycling. Rho H may be involved in the functional differentiation of T cells and in cytoskeleton organization. The RhoH/TTF (ARHH) gene maps to chromosome 4p13 and encodes a 191 -amino acid polypeptide.

Specifications

• Accession Number: Q15669
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 399
• Name: Human RhoH (aa 22-96) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5830400A04Rik; ARHH; AU019774; GTP-binding protein TTF; ras homolog family member H; ras homolog gene family, member H; RHOH; rho-related GTP-binding protein RhoH; Translocation three four protein; TTF; TTF, translocation three four
• Common Name: RhoH
• Gene Symbol: RHOH
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining