Invitrogen™ Human RISC (aa 119-191) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103962	100 μL

Catalog No. RP103962 Supplier Invitrogen™ Supplier No. RP103962

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The RNA-induced silencing complex (RISC) is a key player in the regulation of gene expression through RNA interference (RNAi) mechanisms. It operates by utilizing small RNA molecules-such as microRNAs (miRNAs), small interfering RNAs (siRNAs), and PIWI-interacting RNAs (piRNAs)-which are processed from double-stranded RNA precursors by enzymes like Drosha and Dicer in animals, and DICER-LIKE in plants. RISC is a versatile molecular complex consisting of Argonaute proteins as its core component, which guides the complex to the target RNA by complementary base pairing. Once assembled, RISC can recruit other proteins that mediate gene silencing by degrading or inhibiting the translation of the target RNA. This post-transcriptional regulation system is integral to numerous biological processes, allowing cells to control gene expression finely and respond to endogenous and exogenous signals. The functionality of RISC in gene silencing highlights its significance in the broader context of genetic regulation and has implications in therapies that target gene expression through RNAi.

Specifications

• Accession Number: Q9HB40
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 59342
• Name: Human RISC (aa 119-191) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2410018F01Rik; 4833411K15Rik; AI957256; HSCP1; MSTP034; retinoid inducible serine carboxypeptidase; retinoid-inducible serine carboxypeptidase; retinoid-inducible serine caroboxypeptidase; retinoid-inducible serine caroboxypetidase; Risc; SCP1; SCPEP1; Serine carboxypeptidase 1; serine carboxypeptidase 1 precursor protein; serine caroboxypeptidase 1; UNQ265/PRO302
• Common Name: RISC
• Gene Symbol: SCPEP1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GTGFSYVNGSGAYAKDLAMVASDMMVLLKTFFSCHKEFQTVPFYIFSESYGGKMAAGIGLELYKAIQRGTIKC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining