Invitrogen™ Human RNase12 (aa 76-146) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100351	100 μL

Catalog No. RP100351 Supplier Invitrogen™ Supplier No. RP100351

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60640. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Probable inactive ribonuclease-like protein 12, RNASE 12, belongs to the pancreatic ribonuclease family and does not exhibit any ribonuclease activity.

Specifications

• Accession Number: Q5GAN4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 493901
• Name: Human RNase12 (aa 76-146) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: epididymis secretory sperm binding protein Li 85p; HEL-S-85p; Probable inactive ribonuclease-like protein 12; Rai1; RGD1307829; ribonuclease 12; ribonuclease A family member 12 (inactive); ribonuclease A I1; ribonuclease, RNase A family, 12 (non-active); ribonuclease-like protein 12; RNASE12; RNS12
• Common Name: RNase12
• Gene Symbol: RNASE12
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: INGICISPKKVACQNLSAIFCFQSETKFKMTVCQLIEGTRYPACRYHYSPTEGFVLVTCDDLRPDSFLGYV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining