Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human RNaseL (aa 605-733) Control Fragment Recombinant Protein

Catalog No. RP110224
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP110224 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP110224 Supplier Invitrogen™ Supplier No. RP110224
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

A virally induced endoribonuclease, RNase L is the terminal factor of the anti-viral action of interferon. Activation of RNase L results in inhibition of viral proliferation. Activation of RNase L has also been determined to degrade RNA, thus, initiating a cellular stress response, inducing apoptosis. Since mutations in RNase L relate to an increased incidence of prostate cancer, the activation of RNase L functions in counteracting prostate cancer, via apoptosis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q05823
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 6041
Name Human RNaseL (aa 605-733) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 2',5'-oligoisoadenylate synthetase-dependent; 2-5A-dependent ribonuclease; 2-5A-dependent RNAase; 2-5A-dependent RNase; E230029I04Rik; I79_009550; interferon-induced 2-5A-dependent RNase; PRCA1; Ribonuclease 4; ribonuclease L; ribonuclease L (2 5-oligoisoadenylate synthetase-dependent); ribonuclease L (2', 5'-oligoisoadenylate synthetase-dependent); ribonuclease L (2, 5-oligoisoadenylate synthetase-dependent); ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent); RNase L; Rnasel; RNS4
Common Name RNaseL
Gene Symbol RNASEL
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.