Invitrogen™ Human RNF14 (aa 101-197) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109069	100 μL

Catalog No. RP109069 Supplier Invitrogen™ Supplier No. RP109069

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Five alternatively spliced transcript variants encoding two distinct isoforms have been reported.

Specifications

• Accession Number: Q9UBS8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9604
• Name: Human RNF14 (aa 101-197) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2310075C09Rik; 2610005D23Rik; AA986456; androgen receptor associated protein 54; androgen receptor associated protein 54 (androgen receptor coactivator); androgen receptor-associated protein 54; ARA54; AU041447; D18Ertd188e; D7Bwg0165e; E3 ubiquitin-protein ligase RNF14; HFB30; HRIHFB2038; LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase RNF14; protein Triad2; RING finger protein 14; RNF14; TRIAD2; Triad2 protein; TRIAD2 type I
• Common Name: RNF14
• Gene Symbol: RNF14
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining