Invitrogen™ Human RNF166 (aa 97-189) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98678	100 μL

Catalog No. RP98678 Supplier Invitrogen™ Supplier No. RP98678

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111169. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RNF166 (RING finger protein 166) is a 237 amino acid protein that contains one RING-type zinc finger and a UIM (ubiquitin-interacting motif) repeat. Existing as two alternatively spliced isoforms, RNF166 is encoded by a gene that maps to human chromosome 16q24.3. Chromosome 16 encodes over 900 genes and comprises nearly 3% of the human genome. The GAN gene is located on chromosome 16 and, with mutation, may lead to giant axonal neuropathy, a nervous system disorder characterized by increasing malfunction with growth. The rare disorder Rubinstein-Taybi syndrome is also associated with chromosome 16, as is Crohn's disease, which is a gastrointestinal inflammatory condition.

Specifications

• Accession Number: Q96A37
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 115992
• Name: Human RNF166 (aa 97-189) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1110031E24Rik; AW555115; E3 ubiquitin-protein ligase RNF166; RING finger protein 166; RING-type E3 ubiquitin transferase RNF166; RNF166; Zfp313l; zinc finger protein 313; zinc finger protein 228
• Common Name: RNF166
• Gene Symbol: RNF166
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PCRGCNKKVTLAKMRVHISSCLKVQEQMANCPKFVPVVPTSQPIPSNIPNRSTFACPYCGARNLDQQELVKHCVESHRSDPNRVVCPICSAMP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining