Invitrogen™ Human RNF186 (aa 75-148) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95715	100 μL

Catalog No. RP95715 Supplier Invitrogen™ Supplier No. RP95715

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56972. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The RNF186 gene encodes the RING finger protein 186, a member of the RING-type E3 ubiquitin ligase family. RNF186 is involved in the ubiquitin-proteasome pathway, playing a crucial role in tagging target proteins for degradation, thus influencing protein turnover and cellular homeostasis. This process is essential for regulating various cellular functions, including signal transduction, apoptosis, and response to stress. RNF186 has been implicated in the unfolded protein response (UPR) within the endoplasmic reticulum, where it helps in managing protein folding and maintaining cellular homeostasis, particularly under conditions of endoplasmic reticulum stress. Alterations in RNF186 expression or function have been associated with disorders such as inflammatory bowel disease and ulcerative colitis, suggesting its role in gastrointestinal health and disease. Research into RNF186 focuses on its regulatory mechanisms within the ubiquitin-proteasome system and its potential as a therapeutic target for conditions associated with protein misfolding and cellular stress responses.

Specifications

• Accession Number: Q9NXI6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 54546
• Name: Human RNF186 (aa 75-148) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 9130020G10Rik; E3 ubiquitin-protein ligase RNF186; RING finger protein 186; RNF186
• Common Name: RNF186
• Gene Symbol: RNF186
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DNTWSITCPLCRKVTAVPGGLICSLRDHEAVVGQLAQPCTEVSLCPQGLVDPADLAAGHPSLVGEDGQDEVSAN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining