Invitrogen™ Human RNMTL1 (aa 123-222) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP93453	100 μL

Catalog No. RP93453 Supplier Invitrogen™ Supplier No. RP93453

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54671. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The RNA methyltransferase like 1 gene (RNMTL1) is one of thirteen newly discovered genes within a 116 Kb segment of the chromosome 17p13.3, which suffers from a high frequent loss of heterozygosity in human hepatocellular carcinoma. Its amino acid sequence was identified a high conserved region with methylases from various microorganisms, suggesting to have function to transfer methyl group to rRNA molecule.

Specifications

• Accession Number: Q9HC36
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 55178
• Name: Human RNMTL1 (aa 123-222) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 16S rRNA (guanosine(1370)-2'-O)-methyltransferase; 16S rRNA [Gm1370] 2'-O-methyltransferase; 4833420N02Rik; AI255153; HC90; mitochondrial rRNA methyltransferase 3; MRM3; putative RNA methyltransferase; RGD1309077; RMTL1; RNA methyltransferase like 1; RNA methyltransferase-like protein 1; RNMTL1; rRNA methyltransferase 3, mitochondrial
• Common Name: RNMTL1
• Gene Symbol: MRM3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ILLEGRRLISDALKAGAVPKMFFFSRLEYLKELPVDKLKGVSLIKVKFEDIKDWSDLVTPQGIMGIFAKPDHVKMTYPKTQLQHSLPLLLICDNLRDPGN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining