Invitrogen™ Human ROBO1 (aa 1532-1634) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106430	100 μL

Catalog No. RP106430 Supplier Invitrogen™ Supplier No. RP106430

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65752. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specialized cells at the midline, which separates the left and right halves of the CNS, have a number of roles in directing growth cone behavior. In the vertebrate spinal cord, the insect ventral nerve cord and in C. elegans, midline cells produce guidance cues such as nectins and slit, which act as attractants and repellents, respectively. These cells may act as gatekeepers to prevent axons from crossing the midline and to induce a switch in growth cone responsiveness to guidance cues beyond the gateway. One such gatekeeper, Robo, is an axon guidance receptor that defines a novel subfamily of Ig superfamily proteins that are conserved from fruit flies to mammals. Robo acts as a receptor for the repellent Slit and functions in a cell-autonomous fashion. Non-crossing axons express high levels of Robo, whereas crossing axons express low levels of Robo before reaching the midline and high levels after they cross. Robo1 and Robo2 are two human homologs of the Drosophila protein Roundabout. Robo1 is also homologous to the C. elegans gene sax3, whereas Robo2 is homologous to the zebrafish gene astray.

Specifications

• Accession Number: Q9Y6N7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6091
• Name: Human ROBO1 (aa 1532-1634) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AW494633; AW742721; deleted in U twenty twenty; DUTT1; FLJ21882; Gm310; HGNC:10249; H-Robo-1; MGC131599; MGC133277; ROBO1; roundabout 1; roundabout guidance receptor 1; roundabout homolog 1; roundabout homolog 1 (Drosophila); roundabout, axon guidance receptor, homolog 1; roundabout, axon guidance receptor, homolog 1 (Drosophila); Roundabout1 protein; SAX3
• Common Name: ROBO1
• Gene Symbol: ROBO1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: REVLDGRQVVDMRTNPGDPREAQEQQNDGKGRGNKAAKRDLPPAKTHLIQEDILPYCRPTFPTSNNPRDPSSSSSMSSRGSGSRQREQANVGRRNIAEMQVLG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining