Invitrogen™ Human RPLP0 (aa 149-231) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109354	100 μL

Catalog No. RP109354 Supplier Invitrogen™ Supplier No. RP109354

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins. It is a neutral phosphoprotein with a C-terminal end that is nearly identical to the C-terminal ends of the acidic ribosomal phosphoproteins P1 and P2. The P0 protein can interact with P1 and P2 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. The protein is located in the cytoplasm. Transcript variants derived from alternative splicing exist; they encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Specifications

• Accession Number: P05388
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6175
• Name: Human RPLP0 (aa 149-231) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 36B4; 60S acidic ribosomal protein P0; 60S acidic ribosomal protein P0-like protein; 60S ribosomal protein L10E; acidic ribosomal phophoprotein; acidic ribosomal phophoprotein P0; acidic ribosomal phosphoprotein P0; acidic ribosomal phosphoprotein PO; arbp; arp; fa56b12; fb04a12; L10E; Large ribosomal subunit protein uL10; LP0; MGC107165; MGC107166; MGC111226; MGC88175; neutral ribosomal phosphoprotein P0; OTTMUSP00000015585; P0; PRLP0; ribosomal protein lateral stalk subunit P0; ribosomal protein P0; ribosomal protein, large, P0; RPLP0; rplp0 protein; rplRP; RPP0; similar to acidic ribosomal phosphoprotein PO; wu:fa56b12; wu:fb15a08; wu:fk48c12
• Common Name: RPLP0
• Gene Symbol: RPLP0
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining