Invitrogen™ Human RPLP2 (aa 1-44) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP101680	100 μL

Catalog No. RP101680 Supplier Invitrogen™ Supplier No. RP101680

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62820. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit.Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal phosphoprotein that is a component of the 60S subunit. The protein, which is a functional equivalent of the E. coli L7/L12 ribosomal protein, belongs to the L12P family of ribosomal proteins.It plays an important role in the elongation step of protein synthesis. Unlike most ribosomal proteins, which are basic, the encoded protein is acidic. Its C-terminal end is nearly identical to the C-terminal ends of the ribosomal phosphoproteins P0 and P1. The P2 protein can interact with P0 and P1 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. The protein is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. (provided by RefSeq, Jul 2008).

Specifications

• Accession Number: P05387
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6181
• Name: Human RPLP2 (aa 1-44) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2700049I22Rik; 60S acidic ribosomal protein P2; acidic ribosomal phosphoprotein P2; D11S2243E; L RP D11S2243E; Large ribosomal subunit protein P2; LP2; P2; Renal carcinoma antigen NY-REN-44; ribosomal protein lateral stalk subunit P2; ribosomal protein P2; ribosomal protein, large P2; ribosomal protein, large, P2; RP2; Rplp2; RPP2
• Common Name: RPLP2
• Gene Symbol: RPLP2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVIS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining