Invitrogen™ Human RRP9 (aa 253-358) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92413	100 μL

Catalog No. RP92413 Supplier Invitrogen™ Supplier No. RP92413

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58545. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Ku autoantigen is a heterodimer of 70kDa (p70) and approximately 80kDa (p80) proteins. The p70/p80 dimer is important for function of a 460kDa DNA-dependent protein kinase that phosphorylates certain transcription factors, including Sp1, Oct-1, p53, and SV40 large T antigen in vitro. Ku protein plays a role in cell signaling, proliferation, DNA repair, replication, transcriptional activation, and apoptosis.

Specifications

• Accession Number: O43818
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9136
• Name: Human RRP9 (aa 253-358) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 55kDa; D19435; D9Wsu10e; ribosomal RNA processing 9, small subunit (SSU) processome component, homolog; ribosomal RNA processing 9, small subunit (SSU) processome component, homolog (yeast); ribosomal RNA processing 9, U3 small nucleolar RNA binding protein; RNA, U3 small nucleolar interacting protein 2; RNU3IP2; Rrp9; RRP9 homolog; RRP9, small subunit (SSU) processome component, homolog; RRP9, small subunit (SSU) processome component, homolog (yeast); U3 small nucleolar ribonucleoprotein-associated 55 kDa protein; U3 small nucleolar RNA-interacting protein 2; U3 snoRNP-associated 55 kDa protein; U3 snoRNP-associated 55-kDa protein; U3 snoRNP-associated protein; U355K; U3-55k
• Common Name: RRP9
• Gene Symbol: RRP9
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: THQLYSTSHDRSVKVWNVAENSYVETLFGHQDAVAALDALSRECCVTAGGRDGTVRVWKIPEESQLVFYGHQGSIDCIHLINEEHMVSGADDGSVALWGLSKKRPL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining