Invitrogen™ Human RSK1 (aa 654-735) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89779	100 μL

Catalog No. RP89779 Supplier Invitrogen™ Supplier No. RP89779

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RPS6KA1 (RSK1) is a growth-factor regulated serine/threonine kinase that is involved in the MAPK cascade. It is thought to control cellular proliferation and differentiation through the phosphorylation of transcription factors. RPS6KA1 contains 2 nonidentical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Specifications

• Accession Number: Q15418
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6195
• Name: Human RSK1 (aa 654-735) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 90 kDa ribosomal protein S6 kinase 1; dJ590P13.1 (ribosomal protein S6 kinase, 90kD, polypeptide 1); hu-1; MAP kinase-activated protein kinase 1; MAP kinase-activated protein kinase 1a; MAPK-activated protein kinase 1; MAPK-activated protein kinase 1a; MAPKAP kinase 1; MAPKAP kinase 1a; MAPKAPK-1; mapkapk1a; MAPKAPK-1a; p90Rsk; P90-RSK; p90-RSK 1; p90Rsk1; p90-Rsk1; p90S6K; pp90RSK1; ribosomal protein S6 kinase 2 alpha; ribosomal protein S6 kinase 2 beta; ribosomal protein S6 kinase a, polypeptide 1; ribosomal protein S6 kinase A1; ribosomal protein S6 kinase A1 L homeolog; ribosomal protein S6 kinase alpha 1; Ribosomal protein S6 kinase alpha-1; Ribosomal protein S6 kinase II alpha; ribosomal protein S6 kinase II beta; ribosomal protein S6 kinase polypeptide 1; ribosomal protein S6 kinase, 90kD, polypeptide 1; Ribosomal protein S6 kinase, 90kD, 1; ribosomal protein S6 kinase, 90kDa, polypeptide 1; ribosomal protein S6 kinase, 90kDa, polypeptide 1 L homeolog; ribosomal protein S6 kinase, polypeptide A1; ribosomal S6 kinase 1; RPS6KA; Rps6ka1; rps6ka1.L; RPS6KA1L; rsk; RSK1; Rsk-1; S6 kinase II beta; S6 protein kinase (Rsk-1); S6K-alpha 1; S6K-alpha-1; S6KII-alpha; S6KII-beta; wu:fc56h07; XELAEV_18012109mg; zgc:152654
• Common Name: RSK1
• Gene Symbol: RPS6KA1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining