Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human RSK3 (aa 379-418) Control Fragment Recombinant Protein

Catalog No. RP103924
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP103924 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP103924 Supplier Invitrogen™ Supplier No. RP103924
  • $283.00
    $212.25 / Each of 1

    Save $70.75

    25% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RPS6KA2 (RSK3) serine/threonine kinase is a member of the ribosomal S6 kinase (RSK) family. It is believed that RPS6KA2 is a signal-transducing intermediate in the cellular response to several growth factors. It is found in many tissues, but in higher levels in lung and skeletal muscle. The p90 ribosomal S6 kinases (RSK)1-4 are downstream members of the extracellular signal-regulated kinase (ERK)/MAPK cascade. The loss of RSK2 activity in humans leads to Coffin-Lowry syndrome, which is characterized by mental retardation and growth deficits and may have a tonic regulation on G-protein coupled signaling.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q15349
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 6196
Name Human RSK3 (aa 379-418) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 90 kDa ribosomal protein S6 kinase 2; 90kDa; D17Wsu134e; HU-2; MAP kinase-activated protein kinase 1c; MAPK-activated protein kinase 1c; MAPKAP kinase 1C; MAPKAPK1C; MAPKAPK-1c; mitogen-activated protein kinase-activated protein kinase 1C; p90rsk; p90-RSK 2; p90RSK2; p90-RSK3; pp90rsk; pp90RSK3; Protein-tyrosine kinase Mpk-9; ribosomal protein S6 kinase A2; ribosomal protein S6 kinase alpha 2; ribosomal protein S6 kinase alpha-2; ribosomal protein S6 kinase polypeptide 2; ribosomal protein S6 kinase, 90kD, polypeptide 2; ribosomal protein S6 kinase, 90kDa, polypeptide 2; ribosomal protein S6 kinase, polypeptide 2; ribosomal S6 kinase 3; Rps6ka2; Rps6ka-rs1; RSK; Rsk3; RSK-3; S6K-alpha; S6K-alpha 2; S6K-alpha2; S6K-alpha-2
Common Name RSK3
Gene Symbol RPS6KA2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VASSLIQEPSQQDLHKVPVHPIVQQLHGNNIHFTDGYEIK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.