Invitrogen™ Human RTDR1 (aa 7-78) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92351	100 μL

Catalog No. RP92351 Supplier Invitrogen™ Supplier No. RP92351

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53796. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RTDR1 (Rhabdoid tumor deletion region protein 1) is a 348 amino acid protein that is expressed in adult spinal cord, skeletal muscle, cerebellum and spleen, as well in some rhabdoid tumors. The gene encoding RTDR1 maps to human chromosome 22, which contains over 500 genes and about 49 million bases.

Specifications

• Accession Number: Q9UHP6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 27156
• Name: Human RTDR1 (aa 7-78) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4933431K05Rik; MGC16968; Radial spoke head 14 homolog; radial spoke head homolog 14 (Chlamydomonas); rhabdoid tumor deletion region gene 1; rhabdoid tumor deletion region protein 1; Rsph14; Rtdr1
• Common Name: RTDR1
• Gene Symbol: RSPH14
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMALCDLMHDPECIYKAMNIGCMENLKALLKD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining