Invitrogen™ Human RTP4 (aa 163-225) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107799	100 μL

Catalog No. RP107799 Supplier Invitrogen™ Supplier No. RP107799

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67154. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RTP4 belongs to the TMEM7 family. The function of this protein remains unknown.

Specifications

• Accession Number: Q96DX8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 64108
• Name: Human RTP4 (aa 163-225) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 28 kDa interferon-responsive protein; 28kD interferon alpha responsive protein; 28kD interferon responsive protein; 3CxxC-type zinc finger protein 4; 5830458K16Rik; IFRG28; receptor (chemosensory) transporter protein 4; receptor transporter protein 4; receptor transporting protein 4; receptor-transporting protein 4; Rtp4; Z3CXXC4; zinc finger, 3CxxC-type 4
• Common Name: RTP4
• Gene Symbol: RTP4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GQGLKSCMTKPSKSLLPHLKTGNSSPGIGAVYLANQAKNQSAEAKEAKGSGYEKLGPSRDPDP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining