Invitrogen™ Human Rubicon (aa 407-497) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100145	100 μL

Catalog No. RP100145 Supplier Invitrogen™ Supplier No. RP100145

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62974. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Two Beclin-1-interacting proteins, the run domain Beclin-1 interacting and cysteine-rich containing protein (Rubicon) and ATG14L, reciprocally regulate autophagy at different stages. Knockdown of Rubicon caused enhancement of autophagy while that of ATG14L caused a defect in autophagosome formation. Rubicon functions as part of a Beclin-1-PIK3C3-containing autophagy complex and is also an essential, positive regulator of the NAPDH oxidase complex. Upon microbial infection or TLR2 activation, Rubicon interacts with the CYBA subunit of the NAPDH oxidase complex, leading to a burst of reactive oxygen species and inflammatory cytokines.

Specifications

• Accession Number: Q92622
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9711
• Name: Human Rubicon (aa 407-497) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1700021K19Rik; 5330403K09; baron; Beclin-1 associated RUN domain containing protein; KIAA0226; mKIAA0226; RGD1305422; RIKEN cDNA 1700021K19 gene; RUBCN; Rubicon; RUN and cysteine rich domain containing beclin 1 interacting protein; RUN domain and cysteine-rich domain containing, Beclin 1-interacting protein; run domain Beclin-1 interacting and cysteine-rich containing protein; run domain Beclin-1 interacting and cystein-rich containing protein; run domain Beclin-1-interacting and cysteine-rich domain-containing protein; RUN domain protein as Beclin 1-interacting and cysteine-rich containing; rundataxin; SCAR15; similar to mKIAA0226 protein
• Common Name: Rubicon
• Gene Symbol: RUBCN
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RSHSDTSIASRGAPESCNDKAKLRGPLPYSGQSSEVSTPSSLYMEYEGGRYLCSGEGMFRRPSEGQSLISYLSEQDFGSCADLEKENAHFS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining