Invitrogen™ Human RUNX1 (aa 234-337) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100754	100 μL

Catalog No. RP100754 Supplier Invitrogen™ Supplier No. RP100754

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82141. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RUNX1 belongs to the mammalian RUNX family of DNA binding proteins that regulate the expression of genes involved in cellular differentiation and cell cycle progression. RUNX1 is essential for hematopoietic stem cell generation in the vascular regions of the aorta, vitelline and umbilical arteries, yolk sac and placenta. RUNX1 is expressed in all tissues except brain and heart, with highest levels in thymus, bone marrow and peripheral blood.

Specifications

• Accession Number: Q01196
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 861
• Name: Human RUNX1 (aa 234-337) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: acute myeloid leukemia 1 protein; Acute myeloid leukemia 2 protein; acute myeloid leukemia 3 protein; acute myeloid leukemia gene 2; AML1; AML-1; aml1 oncogene; AML1-EVI-1; AML1-EVI-1 fusion protein; AML2; AML3; AMLCR1; CBF2alpha; CBFA1; CBFA2; CBFA3; CBF-alpha 2; CBF-alpha-1; CBF-alpha-2; CBF-alpha-3; CCD; CCD1; CLCD; core binding factor alpha 2; core-binding factor runt domain alpha subunit 2 (acute myeloid leukemia 1 oncogene); Core-binding factor subunit alpha-1; Core-binding factor subunit alpha-2; core-binding factor subunit alpha-3; core-binding factor, runt domain, alpha subunit 1; core-binding factor, runt domain, alpha subunit 2; core-binding factor, runt domain, alpha subunit 3; EVI-1; Oncogene AML-1; oncogene AML-2; Oncogene AML-3; OSF2; OSF-2; osteoblast-specific transcription factor 2; OTTHUMP00000108697; OTTHUMP00000108700; OTTHUMP00000108702; PEA2 alpha C; PEA2aA; PEA2-alpha A; PEA2-alpha B; PEA2-alpha C; PEBP2 alpha C; PEBP2A; Pebp2a2; PEBP2A3; PEBP2aA; PEBP2aB; PEBP2aC; PEBP2alpha; PEBP2-alpha A; PEBP2-alpha B; PEBP2-alpha C; Pebpa2b; polyomavirus enhancer-binding protein 2 alpha A subunit; Polyomavirus enhancer-binding protein 2 alpha B subunit; polyomavirus enhancer-binding protein 2 alpha C subunit; RUN1; runt domain, alpha subunit 2; runt related transcription factor 1; runt related transcription factor 2; runt related transcription factor 3; runt-related transcription factor 1; Runt-related transcription factor 2; runt-related transcription factor 3; Runx1; RUNX1/ZNF687 fusion; RUNX2; RUNX3; SL3/AKV core-binding factor alpha A subunit; SL3/AKV core-binding factor alpha B subunit; SL3/AKV core-binding factor alpha C subunit; SL3-3 enhancer factor 1 alpha A subunit; SL3-3 enhancer factor 1 alpha B subunit; SL3-3 enhancer factor 1 alpha C subunit; transcription factor; transcription factor AML2
• Common Name: RUNX1
• Gene Symbol: RUNX1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining