Invitrogen™ Human S100A8 (aa 2-78) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89172	100 μL

Catalog No. RP89172 Supplier Invitrogen™ Supplier No. RP89172

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82881. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis.

Specifications

• Accession Number: P05109
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6279
• Name: Human S100A8 (aa 2-78) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 60B8AG; AI323541; B8Ag; CAGA; CAGB; calgranulin A; calgranulin B; calgranulin-A; Calgranulin-B; calprotectin L1H subunit; Calprotectin L1L subunit; CFAg; CGLA; CGLB; chemotactic cytokine CP-10; chemotactic S100 protein; CP-10; Cystic fibrosis antigen; L1Ag; leukocyte L1 complex heavy chain; Leukocyte L1 complex light chain; LIAG; MA387; MAC387; MIF; Migration inhibitory factor-related protein 14; migration inhibitory factor-related protein 8; MRP14; MRP-14; MRP8; MRP-8; NIF; P14; p8; Pro-inflammatory S100 cytokine; protein S100-A8; Protein S100-A9; S100 A8; S100 calcium binding protein A8; S100 calcium binding protein A8 (calgranulin A); S100 calcium binding protein A9; S100 calcium-binding protein A8; S100 calcium-binding protein A8 (calgranulin A); S100 calcium-binding protein A9; S100 calcium-binding protein A9 (calgranulin B); S100A8; S100A9; Urinary stone protein band A
• Common Name: S100A8
• Gene Symbol: S100A8
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining