Invitrogen™ Human S100A9 (aa 3-100) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP101916	100 μL

Catalog No. RP101916 Supplier Invitrogen™ Supplier No. RP101916

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82145. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

S100A9 (MRP-14) is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis.

Specifications

• Accession Number: P06702
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6280
• Name: Human S100A9 (aa 3-100) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 60B8AG; AW546964; BEE22; BM-009; Cagb; calgranulin B; calgranulin-B; Calprotectin L1H subunit; CFAG; CGLB; DKFZp686B04128; GAGB; intracellular calcium-binding protein (MRP14); L1AG; Leukocyte L1 complex heavy chain; LIAG; MAC387; Macrophage; MIF; Migration inhibitory factor-related protein 14; Monocyte; MRP14; MRP-14; MRP15; MRP16; myeloid-related protein 14; NIF; P14; protein S100-A9; S100 A9; S100 calcium binding protein A9; S100 calcium binding protein A9 (calgranulin B); S100 calcium-binding protein A9; S100 calcium-binding protein A9 (calgranulin B); S100a9
• Common Name: S100A9
• Gene Symbol: S100A9
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining