Invitrogen™ Human SAA4 (aa 25-63) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100823	100 μL

Catalog No. RP100823 Supplier Invitrogen™ Supplier No. RP100823

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63819. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Serum Amyloid A4 (SAA4) is a gene that encodes one of the constitutively expressed serum amyloid proteins. Located on chromosome 11, SAA4 is part of the serum amyloid A (SAA) superfamily, which includes other highly homologous genes like SAA1, SAA2, and SAA3. Unlike its counterparts, SAA4 is not an acute-phase reactant but is persistently expressed across different tissues, including plasma, where it associates with high-density lipoprotein (HDL). SAA4 is involved in lipid metabolism and inflammatory responses, albeit not directly induced by inflammatory stimuli like other SAA proteins. It appears as multiple isoforms, some of which may be glycosylated. Recent studies have shown that SAA4 expression encompasses a broad spectrum of physiological conditions and may serve as a marker in diseases involving chronic inflammation and persistent pathological states such as neovascular age-related macular degeneration. The gene's constitutive expression pattern suggests its fundamental role in maintaining homeostasis rather than responding dynamically to acute inflammatory challenges.

Specifications

• Accession Number: P35542
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6291
• Name: Human SAA4 (aa 25-63) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: amyloid A-5 protein; Constitutively expressed serum amyloid A protein; CSAA; C-SAA; Saa4; Saa-4; Saa5; Saa-5; serum amyloid A 4; serum amyloid A-4 protein; serum amyloid A4, constitutive
• Common Name: SAA4
• Gene Symbol: Saa4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining