Invitrogen™ Human SALL4 (aa 245-376) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP91610	100 μL

Catalog No. RP91610 Supplier Invitrogen™ Supplier No. RP91610

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Sall4 protein is encoded by the Sall4 gene located on chromosome 20 in humans and belongs to the Spalt-like protein family. It plays an important role in somatic stem cell maintenance and is studied as a stem cell biomarker. It is a zinc finger transcription factor that is upregulated during development and shown to interact with Oct4 and Sox2. It also forms a complex with Nanog to maintain the pluripotency of Embryonic Stem cells (ESCs). Several current research studies focus on its function as an oncogene and tumor biomarker. Some of the reported target genes of Sall4 include p53, Bmi-1, Bcl2 and XIAP.

Specifications

• Accession Number: Q9UJQ4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 57167
• Name: Human SALL4 (aa 245-376) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5730441M18Rik; AA407717; AL022809; AW536104; C330011P20Rik; C78083; C78563; dJ1112F19.1; DRRS; HSAL4; SALL4; sal-like 4; sal-like 4 (Drosophila); sal-like protein 4; spalt like transcription factor 4; spalt-like transcription factor 4; Tex20; Zinc finger protein 797; zinc finger protein SALL4; ZNF797
• Common Name: SALL4
• Gene Symbol: SALL4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HALHSSGAGADTLKTLGSHMSQQVSAAVALLSQKAGSQGLSLDALKQAKLPHANIPSATSSLSPGLAPFTLKPDGTRVLPNVMSRLPSALLPQAPGSVLFQSPFSTVALDTSKKGKGKPPNISAVDVKPKDE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining