Invitrogen™ Human SAP30BP (aa 192-301) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP91680	100 μL

Catalog No. RP91680 Supplier Invitrogen™ Supplier No. RP91680

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111152. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Induces cell death. May act as a transcriptional corepressor of a gene related to cell survival. May be involved in the regulation of beta-2-microglobulin genes. [UniProt].

Specifications

• Accession Number: Q9UHR5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 29115
• Name: Human SAP30BP (aa 192-301) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2700016D05Rik; fb33d03; Hcngp; HSV-1 binding; HTRG; HTRP; RGD1565537; SAP30 binding protein; SAP30-binding protein; Sap30bp; transcriptional regulator protein; transcriptional regulator protein (Hcngp); transcriptional regulator protein HCNGP; Unknown (protein for MGC:142452); wu:fb33d03; zgc:55340
• Common Name: SAP30BP
• Gene Symbol: Sap30bp
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining