Invitrogen™ Human SAPAP3 (aa 413-484) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108767	100 μL

Catalog No. RP108767 Supplier Invitrogen™ Supplier No. RP108767

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139783. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SAP90/PSD-95-associated protein 3 (SAPAP3, also known as DLGAP3) is a member of a protein family whose members specifically interact with PSD-95/SAP90, a membrane-associated guanylate kinase localized at postsynaptic density (PSD) in neuronal cells. Like the other SAPAP proteins, SAPAP3 is thought to be an adaptor protein that also interacts with different synaptic scaffolding proteins, cytoskeletal and signaling components, such as focal adhesion kinase (FAK) and proline-rich tyrosine kinase 2 (PYK2). Both SAPAP3 protein and mRNA are targeted to dendrites, whereas SAPAP1, -2, and -4 mRNAs are detected mainly in cell bodies. Recent experiments have suggested that SAPAP3 may be involved in obsessive-compulsive disorder (OCD), as mice lacking SAPAP3 exhibited OCD-like symptoms which could be relieved by lentiviral-mediated selective expression of SAPAP3 in the striatum of SAPAP3-mutant mice. At least two isoforms are known to exist.

Specifications

• Accession Number: O95886
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 58512
• Name: Human SAPAP3 (aa 413-484) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: BC058433; DAP3; DAP-3; discs large homolog associated protein 3; discs, large (Drosophila) homolog-associated protein 3; disks large-associated protein 3; DLG associated protein 3; Dlgap3; Prpl8; PSD-95/SAP90-associated protein-3; PSD-95/SAP90-binding protein 3; SAP90/PSD 95 associated protein 3; SAP90/PSD-95-associated protein 3; SAPAP3
• Common Name: SAPAP3
• Gene Symbol: DLGAP3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PKTSPKAVARRFTTRRSSSVDQARINCCVPPRIHPRSSIPGYSRSLTTGQLSDELNQQLEAVCGSVFGELES
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining