Invitrogen™ Human SAPCD2 (aa 234-301) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99976	100 μL

Catalog No. RP99976 Supplier Invitrogen™ Supplier No. RP99976

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60632. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plays a role in planar mitotic spindle orientation in retinal progenitor cells (RPCs) and promotes the production of symmetric terminal divisions (By similarity). Negatively regulates the mitotic apical cortex localization of GPSM2. Involved also in positive regulation of cell proliferation and tumor cell growth.

Specifications

• Accession Number: Q86UD0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 89958
• Name: Human SAPCD2 (aa 234-301) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2010317E24Rik; 6030458L21Rik; AL033337; ang; C9orf140; p42.3; Protein Ang; protein C9orf140; protein C9orf140 homolog; SAPCD2; suppressor APC domain containing 2; suppressor APC domain-containing protein 2; TS/MDEP; tumor specificity and mitosis phase-dependent expression protein
• Common Name: SAPCD2
• Gene Symbol: SAPCD2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELEQEKEVLLQGLEMMARGRDWYQQQLQRVQERQRRLGQSRASADFGAAGSPRPLGRLLPKVQEVARC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining