Invitrogen™ Human SCAF8 (aa 966-1065) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95058	100 μL

Catalog No. RP95058 Supplier Invitrogen™ Supplier No. RP95058

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57335. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulates the p53 pathway to control the expansion growth of digestive organs. Target protein binds the repetitive C-terminal domain (CTD) of RNA polymerase II; may act with other CTD binding proteins to link transcription and pre-mRNA processing.

Specifications

• Accession Number: Q9UPN6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 22828
• Name: Human SCAF8 (aa 966-1065) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: A630086M08Rik; A930036P18Rik; AA408306; AI447644; AI448652; AU015035; CCAP7; CDC5L complex-associated protein 7; CTD-binding SR-like protein rA8; fc50c06; fd99c08; KIAA1116; mKIAA1116; protein SCAF8; putative RNA-binding protein 16; RBM16; RNA binding motif protein 16; RNA binding motif protein 16-like; protein SCAF8; RNA-binding motif protein 16; SCAF8; SR-like CTD-associated factor 8; SR-related and CTD-associated factor 8; SR-related CTD associated factor 8; SR-related CTD-associated factor 8; wu:fc50c06; wu:fd99c08
• Common Name: SCAF8
• Gene Symbol: Scaf8
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PRGPFPPGDIFSQPERPFLAPGRQSVDNVTNPEKRIPLGNDNIQQEGDRDYRFPPIETRESISRPPPVDVRDVVGRPIDPREGPGRPPLDGRDHFGRPPV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining