Invitrogen™ Human SCAMP4 (aa 171-229) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99248	100 μL

Catalog No. RP99248 Supplier Invitrogen™ Supplier No. RP99248

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60309. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SCAMPs, or secretory carrier membrane proteins, are membrane proteins that are widely distributed and play a role in membrane trafficking. Most SCAMPs, such as SCAMP1, have N-terminal cytoplasmic NPF repeats, 4 central transmembrane regions, and a short C-terminal cytoplasmic tail. These NPF repeats are likely involved in mediating endocytosis. However, other SCAMPs, like SCAMP4, lack the NPF repeats and are thus unlikely to function in endocytosis. SCAMP4 has been associated with diseases such as Neurodevelopmental Disorder With Brain Abnormalities, Poor Growth, And Dysmorphic Facies and Strabismus.

Specifications

• Accession Number: Q969E2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 113178
• Name: Human SCAMP4 (aa 171-229) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2410022D05Rik; AI448940; AU022392; AW742369; Sc4; scam4; Scamp4; SCAMP-4; Secretory carrier membrane protein 4; secretory carrier-associated membrane protein 4
• Common Name: SCAMP4
• Gene Symbol: SCAMP4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KVHRIYRGAGGSFQKAQTEWNTGTWRNPPSREAQYNNFSGNSLPEYPTVPSYPGSGQWP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining