Invitrogen™ Human SCAPER (aa 85-180) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98089	100 μL

Catalog No. RP98089 Supplier Invitrogen™ Supplier No. RP98089

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61195. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CCNA2/CDK2 regulatory protein that transiently maintains CCNA2 in the cytoplasm.

Specifications

• Accession Number: Q9BY12
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 49855
• Name: Human SCAPER (aa 85-180) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: C430017I08; D530014O03Rik; KIAA1454; KIAA1454-like protein; LOW QUALITY PROTEIN: S phase cyclin A-associated protein in the endoplasmic reticulum; MSTP063; S phase cyclin A-associated protein in the endoplasmic reticulum; S phase cyclin A-associated protein in the ER; SCAPER; S-phase cyclin A associated protein in the ER; S-phase cyclin A-associated protein in the ER; Zfp291; Zinc finger protein 291; znf291
• Common Name: SCAPER
• Gene Symbol: SCAPER
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KSPTKTRHPRKIDLRARYWAFLFDNLRRAVDEIYVTCESDQSVVECKEVLMMLDNYVRDFKALIDWIQLQEKLEKTDAQSRPTSLAWEVKKMSPGR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining