Invitrogen™ Human SCD (aa 10-71) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102344	100 μL

Catalog No. RP102344 Supplier Invitrogen™ Supplier No. RP102344

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Stearoyl-CoA desaturase (SCD; EC 1.14.99.5) is an iron-containing enzyme that catalyzes a rate-limiting step in the synthesis of unsaturated fatty acids. The principal product of SCD is oleic acid, which is formed by desaturation of stearic acid. The ratio of stearic acid to oleic acid has been implicated in the regulation of cell growth and differentiation through effects on cell membrane fluidity and signal transduction. Four SCD isoforms, Scd1 through Scd4, have been identified in mouse. In contrast, only 2 SCD isoforms, SCD1 and SCD5., have been identified in human. SCD1 shares about 85% amino acid identity with all 4 mouse SCD isoforms, as well as with rat Scd1 and Scd2. In contrast, SCD5 shares limited homology with the rodent SCDs and appears to be unique to primates.

Specifications

• Accession Number: O00767
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6319
• Name: Human SCD (aa 10-71) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AA589638; ab; acyl-CoA desaturase; Acyl-CoA desaturase 1; acyl-CoA desaturase 2; AI265570; asebia; delta(9)-desaturase; Delta(9)-desaturase 1; delta(9)-desaturase 2; Delta-9 desaturase; delta-9 desaturase 1; Delta-9 desaturase 2; delta-9-desaturase; FADS5; fatty acid desaturase; Fatty acid desaturase 1; fatty acid desaturase 2; HGNC:10571; hSCD1; MSTP008; OTTHUMP00000020280; predicted protein of HQ0998; PRO0998; PRO1933; Scd; Scd1; Scd-1; Scd2; SCDOS; stearoyl-CoA desaturase; stearoyl-CoA desaturase (delta-9-desaturase); stearoyl-CoA desaturase 1; Stearoyl-CoA desaturase 2; stearoyl-CoA desaturase opposite strand; stearoyl-Coenzyme A desaturase 1; stearoyl-Coenzyme A desaturase 2; stearyl-CoA desaturase
• Common Name: SCD
• Gene Symbol: Scd
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining