Invitrogen™ Human SCIMP (aa 47-141) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP88833	100 μL

Catalog No. RP88833 Supplier Invitrogen™ Supplier No. RP88833

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52254. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SCIMP (SLP adaptor and Csk interacting membrane protein), also known as Nvl, is a palmitoylated transmembrane adaptor protein expressed in professional antigen presenting cells, most prominently in the lymph nodes and spleen. It is associated with tetraspanin-enriched microdomains (together with MHC II). There is a close relationship between SCIMP and tyrosinkinase Lyn, which is constitutively bound to it by its SH3 domain. After MHC II-mediated stimulation in the immunological synapse SCIMP becomes phosphorylated at several tyrosine residues and provides docking sites for Grb2 and SLP65 or SLP76 adaptors transducing the signal downstream, as well as for the kinase Csk with modulatory roles.

Specifications

• Accession Number: Q6UWF3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 388325
• Name: Human SCIMP (aa 47-141) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: A430084P05Rik; C17orf87; DTFT5783; SCIMP; SLP adapter and CSK-interacting membrane protein; SLP adaptor and CSK interacting membrane protein; SLP65/SLP76, Csk-interacting membrane protein; transmembrane protein C17orf87; transmembrane protein C17orf87 homolog; UNQ5783; UNQ5783/PRO16090
• Common Name: SCIMP
• Gene Symbol: SCIMP
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RRGKKWEIAKPLKHKQVDEEKMYENVLNESPVQLPPLPPRNWPSLEDSSPQEAPSQPPATYSLVNKVKNKKTVSIPSYIEPEDDYDDVEIPANTE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining