Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human SCNN1G (aa 302-371) Control Fragment Recombinant Protein

Catalog No. RP107801
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107801 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107801 Supplier Invitrogen™ Supplier No. RP107801
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67155. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Epithelial sodium channels are amiloride-sensitive members of the degenerin/epithelial sodium channel (Deg/ENaC) superfamily of ion channels. Members of this superfamily of ion channels share organizational similarity in that they all possess two short intracellular amino and carboxyl termini, two short membrane spanning segments, and a large extracellular loop with a conserved cysteine-rich region. There are three homologous isoforms of the ENaC (alpha, beta, and gamma) protein. ENaC in the kidney, lung, and colon plays an essential role in trans-epithelial sodium and fluid balance. ENaC also mediates aldosterone-dependent sodium reabsorption in the distal nephron of the kidney, thus regulating blood pressure. ENaC is thought to be regulated, in part, through association with the cystic fibrosis transmembrane conductance regulator (CFTR) chloride ion channel. Gain-of-function mutations in beta- or gamma-ENaC can cause severe arterial hypertension (Liddel's syndrome) and loss-of-function mutations in alpha- or beta-ENaC causes pseudohypoaldosteronism (PHA-1).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P51170
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 6340
Name Human SCNN1G (aa 302-371) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias [g]ENaC; amiloride sensitive sodium channel gamma1 subunit; amiloride-sensitive epithelial sodium channel gamma subunit; amiloride-sensitive sodium channel gamma-subunit; amiloride-sensitive sodium channel subunit gamma; BESC3; ENaC; ENaC gamma; ENaC gamma subunit; ENaCG; ENaCgamma; epithelial Na(+) channel subunit gamma; epithelial sodium channel gamma subunit; Gamma ENaC; Gamma NaCH; gamma-ENaC; Gamma-NaCH; nonvoltage-gated sodium channel 1 subunit gamma; PHA 1; PHA1; SCNEG; SCNN 1G; Scnn1g; sodium channe epithelial 1 gamma subunit; sodium channel epithelial 1 gamma subunit; Sodium channel nonvoltage-gated 1 gamma (epithelial); sodium channel, non voltage gated 1 gamma subunit; sodium channel, nonvoltage-gated 1 gamma; sodium channel, nonvoltage-gated 1, gamma; Sodium channel, nonvoltage-gated 1, gamma (epithelial); sodium channel, non-voltage-gated 1, gamma subunit; sodium channel, nonvoltage-gated, type I, gamma
Common Name SCNN1G
Gene Symbol SCNN1G
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.