Invitrogen™ Human SEMA3A (aa 654-750) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104941	100 μL

Catalog No. RP104941 Supplier Invitrogen™ Supplier No. RP104941

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65715. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the semaphorin family and encodes a protein with an Ig-like C2-type domain, a PSI domain and a Sema domain. This secreted protein can function as either a chemorepulsive agent, inhibiting axonal outgrowth, or as a chemoattractive agent, stimulating the growth of apical dendrites. In both cases, the protein is vital for normal neuronal pattern development. Increased expression of this protein is associated with schizophrenia and is seen in a variety of human tumor cell lines. Also, aberrant release of this protein is associated with the progression of Alzheimer's disease.

Specifications

• Accession Number: Q14563
• Concentration: 1.1 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10371
• Name: Human SEMA3A (aa 654-750) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: COLL1; coll-1; collapsin 1; collapsin-1; HH16; Hsema-I; Hsema-III; MGC133243; sema D; sema domain, immunoglobulin domain (Ig), short basic domain, sec; sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A; sema III; SEMA1; SEMA3A; Semad; SEMAIII; SEMAL; Semaphorin 3a; semaphorin D; semaphorin III; semaphorin L; semaphorin-3A; Semaphorin-D; SemD
• Common Name: SEMA3A
• Gene Symbol: SEMA3A
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HGFIQTLLKVTLEVIDTEHLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHTPGNSNKWKHL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining