Invitrogen™ Human SEMA6A (aa 678-755) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95589	100 μL

Catalog No. RP95589 Supplier Invitrogen™ Supplier No. RP95589

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111018. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SEMA6A can act as repulsive axon guidance cues. It may play a role in channeling sympathetic axons into the sympathetic chains and controlling the temporal sequence of sympathetic target innervation.

Specifications

• Accession Number: Q9H2E6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 57556
• Name: Human SEMA6A (aa 678-755) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 9330158E07; A730020P05Rik; AI851735; b2b997Clo; HT018; KIAA1368; Mutant line 997; SEMA; sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A; sema Q; Sema VIA; SEMA6A; SEMA6A1; SEMA6A-1; semaphorin 6A; semaphorin 6A-1; semaphorin Q; Semaphorin VIA; semaphorin-6A; Semaphorin-6A-1; Semaq; VIA
• Common Name: SEMA6A
• Gene Symbol: SEMA6A
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RKDVAVVQRKEKELTHSRRGSMSSVTKLSGLFGDTQSKDPKPEAILTPLMHNGKLATPGNTAKMLIKADQHHLDLTAL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining