Invitrogen™ Human SEMA6B (aa 451-538) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103230	100 μL

Catalog No. RP103230 Supplier Invitrogen™ Supplier No. RP103230

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63176. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The SEMA6B gene encodes semaphorin 6B, which belongs to the semaphorin family of proteins known for their roles in guiding axonal development and modulating cellular signaling pathways. Semaphorin 6B primarily functions in the nervous system where it influences axonal guidance, neuronal development, and synapse formation through interactions with neuropilin and plexin receptor complexes. These interactions are crucial during neural development, ensuring proper neuronal wiring and the establishment of functional neural circuits. In addition to its key role in neural connectivity, SEMA6B is increasingly recognized for its involvement in immune responses, where it can modulate the activity and migration of immune cells. In cancer biology, altered expression of SEMA6B has been implicated in tumor progression, affecting tumor cell adhesion and migration, thereby influencing metastasis. Research continues to explore the specific mechanisms of SEMA6B's action and how it can be targeted for therapeutic interventions in neural and cancer-related diseases.

Specifications

• Accession Number: Q9H3T3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10501
• Name: Human SEMA6B (aa 451-538) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Sema; sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6B; sema N; Sema VIB; sema Z; SEMA6B; SEMAN; semaphorin 6B; semaphorin VIB; semaphorin Z; semaphorin-6B; semaphorin-6Ba; semaphorin-N; Semaphorin-Z; SEMA-VIB; semaZ; SEM-SEMA-Y; UNQ1907/PRO4353; VIb
• Common Name: SEMA6B
• Gene Symbol: SEMA6B
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AGTVLKFLVRPNASTSGTSGLSVFLEEFETYRPDRCGRPGGGETGQRLLSLELDAASGGLLAAFPRCVVRVPVARCQQYSGCMKNCIG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining