Invitrogen™ Human SETD5 (aa 551-635) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102672	100 μL

Catalog No. RP102672 Supplier Invitrogen™ Supplier No. RP102672

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This function of this gene has yet to be determined but mutations in this gene have been associated with autosomal dominant mental retardation-23. Alternative splicing results in multiple transcript variants encoding different isoforms.

Specifications

• Accession Number: Q9C0A6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 55209
• Name: Human SETD5 (aa 551-635) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2900045N06Rik; C330007C20; C85544; Histone-lysine N-methyltransferase SETD5; histone-lysine N-methyltransferase SETD5; SET domain-containing protein 5; Kiaa1757; LOW QUALITY PROTEIN: SET domain-containing protein 5; mKIAA1757; RGD1310433; SET domain containing 5; SET domain-containing protein 5; SETD5
• Common Name: SETD5
• Gene Symbol: SETD5
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ETPVGEETKTEAPESEVSNSVSNVTIPSTPQSVGVNTRRSSQAGDIAAEKLVPKPPPAKPSRPRPKSRISRYRTSSAQRLKRQKQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining