Invitrogen™ Human SEZ6L2 (aa 428-509) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103562	100 μL

Catalog No. RP103562 Supplier Invitrogen™ Supplier No. RP103562

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64172. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The SEZ6L2 gene encodes the protein seizure-related 6 homolog-like 2, which plays roles in neural development and synaptic function. SEZ6L2 is part of the SEZ6 protein family recognized for their participation in the formation and maintenance of neural connections. This protein is prominently expressed in the brain and is involved in the molecular processes underlying synaptic differentiation and dendritic growth, crucial for cognitive functions and neurodevelopment. SEZ6L2 interacts with other neural proteins to mediate signaling pathways that regulate the balance between excitation and inhibition in neural circuits, which is vital for proper neurological function and development.

Specifications

• Accession Number: Q6UXD5
• Concentration: 2.3 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 26470
• Name: Human SEZ6L2 (aa 428-509) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI835913; AW121566; Brain-specific receptor-like protein A; BSRPA; BSRP-A; PSK; Psk1; PSK-1; seizure 6-like protein 2; seizure related 6 homolog (mouse)-like 2; seizure related 6 homolog like 2; seizure related 6 homolog-like 2; seizure related 6-like protein 2; SEZ6L2; type I transmembrane receptor (seizure-related protein); UNQ1903/PRO4349
• Common Name: SEZ6L2
• Gene Symbol: SEZ6L2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEYRPGALATFSCLPGYALEPPGPPNAIECV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining