Invitrogen™ Human SFTPD (aa 241-317) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP97082	100 μL

Catalog No. RP97082 Supplier Invitrogen™ Supplier No. RP97082

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83727 (PA5-83727. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Surfactant protein D (SP-D) is synthesized and secreted by lung epithelial cells. It belongs to group III of the family of C-type lectins and members of this group has overall structure consisting of multiple globular 'head' regions linked by triple-helical, collagen-like, strands. This group also includes SP-A and the serum proteins mannan-binding protein, conglutinin and collectin-43, all of which have been shown to bind to the C1q receptor found on a wide variety of cells. Both SP-D and SP-A have been shown to enhance oxygen radical production by alveolar macrophages.

Specifications

• Accession Number: P35247
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6441
• Name: Human SFTPD (aa 241-317) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI573415; COLEC7; Collectin7; collectin-7; CP4; EGK_19692; Lung surfactant protein D; PSPD; PSP-D; PSP-D Surfactant protein D; pulmonary surfactant apoprotein; Pulmonary surfactant associated protein PSP-D; pulmonary surfactant protein D; pulmonary surfactant-associated protein D; SFTP 4; Sftp4; SFTPD; SPD; SP-D; surfactant associated protein D; Surfactant associated protein pulmonary 4; surfactant protein D; surfactant, pulmonary-associated protein D; surfactant-associated protein, pulmonary 4
• Common Name: SFTPD
• Gene Symbol: SFTPD
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining