Invitrogen™ Human SGCE (aa 355-436) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105591	100 μL

Catalog No. RP105591 Supplier Invitrogen™ Supplier No. RP105591

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67363. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the epsilon member of the sarcoglycan family. Sarcoglycans are transmembrane proteins that are components of the dystrophin-glycoprotein complex, which link the actin cytoskeleton to the extracellular matrix. Unlike other family members which are predominantly expressed in striated muscle, the epsilon sarcoglycan is more broadly expressed. Mutations in this gene are associated with myoclonus-dystonia syndrome. This gene is imprinted, with preferential expression from the paternal allele. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: O43556
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 8910
• Name: Human SGCE (aa 355-436) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: dystonia 11, myoclonic; DYT11; EMBL:AAO37579.1, ECO:0000312; EMBL:AAO37579.1}; Epsilon sarcoglycan; Epsilon SG; Epsilon-sarcoglycan; epsilon-sarcoglycan {ECO:0000312; epsilon-SG; epsilon-SG {ECO:0000250; ESG; e-SG; RGD:1303201}; sarcoglycan; sarcoglycan epsilon; sarcoglycan, epsilon; SGCE; sgce {ECO:0000312; UniProtKB:O43556}; UNQ433/PRO840
• Common Name: SGCE
• Gene Symbol: SGCE
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DIQLVHHSAIQKSTKELRDMSKNREIAWPLSTLPVFHPVTGEIIPPLHTDNYDSTNMPLMQTQQNLPHQTQIPQQQTTGKWY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining