Invitrogen™ Human SGSM3 (aa 11-102) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP101148	100 μL

Catalog No. RP101148 Supplier Invitrogen™ Supplier No. RP101148

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61854. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May play a cooperative role in NF2-mediated growth suppression of cells. [UniProt].

Specifications

• Accession Number: Q96HU1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 27352
• Name: Human SGSM3 (aa 11-102) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1810012I01Rik; AI428557; BB175482; Cip85; Cx43-interacting protein of 85-kDa; DKFZp761D051; MAP; merlin binding protein; merlin-associated protein; R75178; RABGAP5; RabGAP-5; RabGAPLP; rab-GTPase-activating protein-like protein; RUN and SH3 containing 3; RUN and TBC1 domain containing 3; RUN and TBC1 domain-containing protein 3; RUSC3; Rutbc3; SGSM3; small G protein signaling modulator 3; small G protein signaling modulator 3 protein
• Common Name: SGSM3
• Gene Symbol: Sgsm3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PFSALTPSIWPQEILAKYTQKEESAEQPEFYYDEFGFRVYKEEGDEPGSSLLANSPLMEDAPQRLRWQAHLEFTHNHDVGDLTWDKIAVSLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining