Invitrogen™ Human SGTB (aa 44-96) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100476	100 μL

Catalog No. RP100476 Supplier Invitrogen™ Supplier No. RP100476

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60795. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SGTB is co-chaperone that binds directly to HSC70 and HSP70 and regulates their ATPase activity.

Specifications

• Accession Number: Q96EQ0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 54557
• Name: Human SGTB (aa 44-96) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Beta-SGT; C630001O05Rik; SGT2; Sgtb; small glutamine rich protein with tetratricopeptide repeats 2; small glutamine rich tetratricopeptide repeat containing beta; small glutamine-rich protein with tetratricopeptide repeats 2; small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta; small glutamine-rich tetratricopeptide repeat-containing protein beta
• Common Name: SGTB
• Gene Symbol: SGTB
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KISPEDTHLAVSQPLTEMFTSSFCKNDVLPLSNSVPEDVGKADQLKDEGNNHM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining