Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP95960

Invitrogen™ Human SH3YL1 (aa 1-69) Control Fragment Recombinant Protein

Catalog No. RP95960
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95960 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95960 Supplier Invitrogen™ Supplier No. RP95960
  • $283.00
    $212.65 / Each of 1

    Save $70.35

    25% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Add to Cart

missing translation for 'validMainframeMsg'

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56594. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The SH3YL1 gene encodes a protein that contains an SH3 domain and is involved in various signaling pathways. It is particularly significant in the context of androgen receptor (AR) signaling, where it acts as a coregulator for AR target genes. Studies have shown that SH3YL1 is essential for the transcriptional activation of genes modulated by the AR, and its dysregulation is associated with aggressive prostate cancer. Additionally, elevated plasma levels of SH3YL1 have been identified as a biomarker for diabetic nephropathy, indicating its broader role in human health and disease. SH3YL1 protein expression is particularly noted in the kidneys of diabetic patients, suggesting its involvement in the development of diabetic complications.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96HL8
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 26751
Name Human SH3YL1 (aa 1-69) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias RAY; SH3 and SYLF domain containing 1; SH3 domain containing, Ysc84-like 1; SH3 domain-containing YSC84-like protein 1; SH3YL1
Common Name SH3YL1
Gene Symbol SH3YL1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAKGLAILSVIKAGFLVTARGGSGIVV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.