Invitrogen™ Human SHIP1 (aa 1042-1133) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104018	100 μL

Catalog No. RP104018 Supplier Invitrogen™ Supplier No. RP104018

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84840. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the inositol polyphosphate-5-phosphatase (INPP5) family and encodes a protein with an N-terminal SH2 domain, an inositol phosphatase domain, and two C-terminal protein interaction domains. Expression of this protein is restricted to hematopoietic cells where its movement from the cytosol to the plasma membrane is mediated by tyrosine phosphorylation. At the plasma membrane, the protein hydrolyzes the 5' phosphate from phosphatidylinositol (3,4,5)-trisphosphate and inositol-1,3,4,5-tetrakisphosphate, thereby affecting multiple signaling pathways. Overall, the protein functions as a negative regulator of myeliod cell proliferation and survival. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Specifications

• Accession Number: Q92835
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3635
• Name: Human SHIP1 (aa 1042-1133) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 7a33; hp51CN; Inositol polyphosphate-5-phosphatase 145 kDa; inositol polyphosphate-5-phosphatase D; Inositol polyphosphate-5-phosphatase of 145 kDa; inositol polyphosphate-5-phosphatase, 145 kDa; inositol polyphosphate-5-phosphatase, 145kD; inositol polyphosphate-5-phosphatase, 145kDa; Inpp5d; MGC104855; MGC142140; MGC142142; OTTHUMP00000165069; OTTHUMP00000165070; OTTHUMP00000165071; OTTHUMP00000165072; OTTHUMP00000203442; p150Ship; phosphatidylin; Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1; Phosphatidylinositol 4,5-bisphosphate 5-phosphatase; phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1; Phosphatidylinositol-4,5-bisphosphate 5-phosphatase; SH2 domain-containing inositol 5'-phosphatase 1; SH2 domain-containing inositol phosphatase 1; SH2 domain-containing inositol-5'-phosphatase 1; SH2-containing inositol phosphatase SHIP; SHIP; SHIP1; SHIP-1; signaling inositol polyphosphate 5 phosphatase SIP-145; signaling inositol polyphosphate phosphatase SHIP II; SIP-145; Src homology 2 domain-containing inositol-5-phosphatase; s-SHIP
• Common Name: SHIP1
• Gene Symbol: INPP5D
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MPRKEPPPCPEPGILSPSIVLTKAQEADRGEGPGKQVPAPRLRSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining