Invitrogen™ Human SIGLEC9 Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90194	100 μL

Catalog No. RP90194 Supplier Invitrogen™ Supplier No. RP90194

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82404. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SIGLEC9 (Sialic acid-binding Ig-like lectin 9) is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. It contains two Ig-like C2 type (immunoglobulin-like) domains and one Ig-like V-type (immunoglobulin-like) domain. It preferentially binds to alpha2, 3-or alpha2, 6-linked sialic acid. The sialic acid recognition site may be mased by cis interactions with sialic acids on the same cell surface.

Specifications

• Accession Number: Q9Y336
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 27180
• Name: Human SIGLEC9 Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Cd170; CD329; CDw329; FOAP-9; LOC100062855; LOC719831; MIS; mSiglec-E; Myeloid inhibitory siglec; OBBP-LIKE; Protein FOAP-9; sialic acid binding Ig like lectin 9; sialic acid binding Ig-like lectin 5; sialic acid binding Ig-like lectin 9; sialic acid binding Ig-like lectin E; sialic acid-binding Ig-like lectin 12; Sialic acid-binding Ig-like lectin 5; sialic acid-binding Ig-like lectin 9; Sialic acid-binding Ig-like lectin E; sialic acid-binding Ig-like lectin-like 1; sialic acid-binding immunoglobulin-like lectin E; Siglec; Siglec12; siglec-12; Siglec5; Siglec-5; SIGLEC9; siglec-9; Siglece; Siglec-E; Siglecl1; siglec-L1; SIGLEC-like 1; UNQ668/PRO1302
• Common Name: SIGLEC9
• Gene Symbol: SIGLEC9
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QNLTMTVFQGDGTVSTVLGNGSSLSLPEGQSLRLVCAVDAVDSNPPARLSLSWRGLTLCPSQPSNPGVLELPWVHLRDEAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining