Invitrogen™ Human SIK3 (aa 604-703) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100419	100 μL

Catalog No. RP100419 Supplier Invitrogen™ Supplier No. RP100419

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60959. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SIK3 (QSK) is a serine/threonine-protein kinase, belongs to QIK subfamily. The phosphorylation of SIK3 by LKB1 through the 14-3-3 binding enhances its catalytic activity and leads its localization to punctate structures within the cytoplasm. Overexpression of SIK3 promotes G1/S cell cycle progression with ovarian cancer. There are two sites (H331L and A1103V) were mutated at significant frequency in breast cancer. SIK3 is a novel tumor-associated antigen (TAA). SIK3 is a positive regulator of mTOR signaling that functions by triggering the degradation of DEPTOR, an mTOR inhibitor. Involved in the dynamic regulation of mTOR signaling in chondrocyte differentiation during skeletogenesis. Negatively regulates cAMP signaling pathway possibly by acting on CRTC2/TORC2 and CRTC3/TORC3.

Specifications

• Accession Number: Q9Y2K2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 23387
• Name: Human SIK3 (aa 604-703) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5730525O22Rik; 9030204A07Rik; AI447252; AI846254; AI849445; Kiaa0999; L19; mKIAA0999; QSK; Salt-inducible kinase 3; serine/threonine-protein kinase QSK; Serine/threonine-protein kinase SIK3; SIK family kinase 3; SIK3; SIK-3
• Common Name: SIK3
• Gene Symbol: SIK3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: STYKDSNTLHLPTERFSPVRRFSDGAASIQAFKAHLEKMGNNSSIKQLQQECEQLQKMYGGQIDERTLEKTQQQHMLYQQEQHHQILQQQIQDSICPPQP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining