Invitrogen™ Human SIN3A (aa 5-99) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103434	100 μL

Catalog No. RP103434 Supplier Invitrogen™ Supplier No. RP103434

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mammalian Sin3 (mSin3) is a 150 kDa protein closely related to the yeast SIN3 repressor protein involved in the transcriptional repression of many genes. There are two mammalian isoforms, mSin3A and mSin3B. Containing 4 paired amphipathic helix domains (PAH domains), mSin3A and mSin3B have been shown to directly interact with several other transcriptional repressor proteins including HDAC1, HDAC2, RbAp46, the methyl CpG binding protein MeCP2, the Mad/Max heterodimer, and the corepressors silencing mediator of retinoic acid and thyroid hormone receptor (SMRT) and nuclear receptor corepressor (N-CoR).

Specifications

• Accession Number: Q96ST3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 25942
• Name: Human SIN3A (aa 5-99) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AW553200; Histone deacetylase complex subunit Sin3a; Kiaa4126; Mammalian Sin3A; mKIAA4126; mSin3A; Paired amphipathic helix protein Sin3a; SIN; Sin3; SIN3 homolog A, transcription regulator; SIN3 transcription regulator family member A; SIN3 transcription regulator homolog A; SIN3A; transcriptional corepressor Sin3a; transcriptional co-repressor Sin3A; transcriptional regulator, SIN3 yeast homolog A; transcriptional regulator, SIN3A; transcriptional regulator, SIN3A (yeast)
• Common Name: SIN3A
• Gene Symbol: SIN3A
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining