Invitrogen™ Human SIPA1L3 (aa 1303-1384) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98995	100 μL

Catalog No. RP98995 Supplier Invitrogen™ Supplier No. RP98995

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59853. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Signal-induced proliferation associated-like protein 2 (SIPA1L3) is a member of the SIPA1 family of RapGAPs. SIPA1L3 was cloned as a novel molecular component of tight junctions and adherens junctions, suggesting that may function to balance Rap1 by counteracting RapGEFs. Recent studies of SIPA indicate that its deregulation can cause myeloproliferative stem cell disorders in mice and increased metastases in human cancers. Other studies suggest SIPA1L1 may play important roles in embryo development and control of cell proliferation. Based on the amount of homology between SIPA family members, it is possible that SIPA1L3 plays other roles development and cell proliferation.

Specifications

• Accession Number: O60292
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 23094
• Name: Human SIPA1L3 (aa 1303-1384) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2610511M17Rik; CTRCT45; KIAA0545; signal induced proliferation associated 1 like 3; signal-induced proliferation-associated 1 like 3; signal-induced proliferation-associated 1-like protein 3; Sipa1l3; SIPA1-like protein 3; SPA-1-like 3; SPA-1-like protein 3; Spal3; SPAR3
• Common Name: SIPA1L3
• Gene Symbol: SIPA1L3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KGGSSDSGIDTTLYTSSPSCMSLAKAPRPAKPHKPPGSMGLCGGGREAAGRSHHADRRREVSPAPAVAGQSKGYRPKLYSSG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining